Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 5(PCR5)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9LS45 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MGRPVGQTNQAQPSVQHTASPSNKVSHNGGIGKPANIPTGIPVNYQQTQNQWSSQLFDCM NDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFVYSYMFRARIRK KFGLPDAPAPDWITHLVCMPFALCQEYRELKHHGFDPILGWAGNVQQAQQQEMMTPPTGQ RMMG Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 5 Short name= AtPCR5 Gene Names: Name: PCR5 Ordered Locus Names: At3g18450 ORF Names: MYF24.17 Expression Region: 1-184 Sequence Info: full length protein