Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 11(PCR11)

https://www.academycancerimmunology.org/web/image/product.template/117040/image_1920?unique=59ef7fb
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9SX24 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MNLSSNDQPSQGRIKAKDWSTDLCECWMDINSCCLTCWCPCVAFGRIAEVVDRGSTSCGV SGAMYMIIFMLTGYGGSSLYSCFYRTKLRAQYNLKERPCCDCCVHFCCEPCALCQEYRQL QHNRDLDLVIGWHGNMERHARLAASTPSAPPLQAPMSRLV Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 11 Short name= AtPCR11 Gene Names: Name: PCR11 Ordered Locus Names: At1g68610 ORF Names: F24J5.15 Expression Region: 1-160 Sequence Info: full length protein

1,082.88 1082.88 USD 1,082.88

1,082.88

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out what's in our lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.