Skip to Content

Recombinant Saccharomyces cerevisiae Protein translocation protein SEC63(SEC63)

https://www.academycancerimmunology.org/web/image/product.template/154586/image_1920?unique=51d8027
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.: P14906 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFK NLNEEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAA TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAY ESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVS RWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPT DFEKLLQDHINRRDSGKLNNAKFRIVAKCHSLLHGLLDIACGFRNLDIALGAINTFKCIV QAVPLTPNCQILQLPNVDKEHFITKTGDIHTLGKLFTLEDAKIGEVLGIKDQAKLNETLR VASHIPNLKIIKADFLVPGENQVTPSSTPYISLKVLVRSAKQPLIPTSLIPEENLTEPQD FESQRDPFAMMSKQPLVPYSFAPFFPTKRRGSWCCLVSSQKDGKILQTPIIIEKLSYKNL NDDKDFFDKRIKMDLTKHEKFDINDWEIGTIKIPLGQPAPETVGDFFFRVIVKSTDYFTT DLDITMNMKVRDSPAVEQVEVYSEEDDEYSTDDDETESDDESDASDYTDIDTDTEAEDDE SPE Protein Names: Recommended name: Protein translocation protein SEC63 Alternative name(s): Protein NPL1 Sec62/63 complex 73 kDa subunit Gene Names: Name: SEC63 Synonyms: NPL1, PTL1 Ordered Locus Names: YOR254C Expression Region: 1-663 Sequence Info: full length protein

1,465.20 1465.2 USD 1,465.20

1,465.20

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out what's in our lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.