Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 3(PCR3)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: P0CW97 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MASQHLQANPHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGA LYVLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYRELKHRGF DMSLGWAGNVEKQQNQGGVAMGAPAFQGGMSR Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 3 Short name= AtPCR3 Gene Names: Name: PCR3 Ordered Locus Names: At5g35525 ORF Names: MOK9 Expression Region: 1-152 Sequence Info: full length protein