Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 9(PCR9)
Volume: 50 ug. Other sizes are also available. Please Inquire.
Product Type: Recombinant Protein
Species: Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.: P0CW98
Tag Info: The tag type will be determined during production process.
Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence: MSEQEGKNEKKVTEGQWTTGLYDCLSEDISTCCFTWVCPCVAFGRIAEILDKGETSRGLA GLMVVAMSSIGCGWYYASKYRAKLRHQYALPEAPCADGAIHCFCCPCALTQEHRELKHRG LDPSLGWNIENGGLNSNTPPFVASGMDR
Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 9 Short name= AtPCR9
Gene Names: Name: PCR9 Ordered Locus Names: At1g58320 ORF Names: F19C14.14
Expression Region: 1-148
Sequence Info: full length protein
Our Products !
Check out what's in our lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.